Safety System & Equipments

Our offered Product range includes Fire and Gas Detectors Alarm, Home Combustible Natural Gas Leak Detector Alarm, DC Power Network LPG Multi Gas Detector Alarm, Gas Leak Detector Alarm and Home Gas Alarm.

Fire And Gas Detectors Alarm Natural Gas Detector Multi Gas Detector Alarm

₹ 598.50 - ₹ 1,026 / Piece Get Latest Price

Min. Order (MOQ) 1 Piece(s)
Type Gas Detector
Material ABS Plastic
Color White
Feature Accuracy, Alarm System, Durable, Easy To Use, Eco Friendly, Rechargeable, Stable Performance
Condition New
Application Gas Detecting
Warranty 2Year
Gas Type Combustible Gas, LPG Gas, Natural Gas

Advancedsemiconductorsensorisadoptedforthelpggassensor.Thelpg/naturalgassensorcanbedetectedlight/soundbythemethodofalarm.itiscanbeusedasindependentfamilygasalarmequipment.Herearethemainfutures:
1.Highstabilitysensor2.Autoself-checkfunction3.Autoresetfunction

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union, ,

Packaging Details : Advanced semiconductor sensor is adopted for the lpg gas sensor. The lpg/natural gas sensor can be detected light/sound by the method of alarm.it is can be used as independent family gas alarm equipment.
Here are the main futures :

1.High stability sensor
2.Auto self-check function
3.Auto reset function
4.the lp gas detector with SMT design
5.Microprocessor adopted

Delivery Time : 5-7days

View Complete Details

Ask Latest Price & Details

Home Combustible Best Natural Gas Leak Detector Alarm With 9v Battery

₹ 598.50 - ₹ 1,026 / Piece Get Latest Price

Min. Order (MOQ) 1 Piece(s)
Type Gas Alarm
Material ABS
Application Home, Office, Shop
Color White
Condition New
Feature Durable, Easy To Install, Eco Friendly, High Accuracy, High Volume, Waterproof
Warranty 2Year
Brand Name Sumring
Application Gas Leak Alarm
Detected gas Lgp Gas/natural Gas/CH4

The product(SR-908NSZ) is a smart combustible gas leak detector with voice prompt, microprocessor control, support displaying of the gas concentration. When trigger the gas detector, it will alarm with build-in siren. This detector adopt catalytic combustion method sensor which is stable and reliable. It keeps the place safe from the threats of combustible gas (such as liquefied petroleum gas, natural gas, pipeline gas, biogas, methane etc.)

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union

Packaging Details :

Delivery Time : 5-7days

View Complete Details

Ask Latest Price & Details

DC Power Network LPG Multi Gas Detector Alarm Gas Detector For Home

₹ 342 - ₹ 513 / Piece Get Latest Price

Min. Order (MOQ) 1 Piece(s)
Type Lpg Gas Detector
Material ABS Plastic
Certification CE Certified
Color White
Feature Accuracy, Durable, Easy To Use, Eco Friendly, Rechargeable, Stable Performance
Application LPG Gas Detecting
Warranty 2Year
Gas Type LPG Gas
Brand Name Sumring
Voltage DC9-24V

main features:

high reliability sensor/mcu processing

combustible gas detector, network/auto reset function

malfunction auto-check indicator

detect natural gas or lpg

sound &led flash alarm output:

execute criterion: gb15322, ul1484, en50194

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union,

Packaging Details : Main features:
High reliability sensor/MCU processing
Combustible gas detector, network/Auto reset function
Malfunction auto-check indicator
Detect natural gas or LPG
Sound &LED flash alarm output:
Execute criterion: GB15322, UL1484, EN50194

Delivery Time : 5-7days

View Complete Details

Ask Latest Price & Details